PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G29750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 257aa    MW: 27545.5 Da    PI: 6.8287
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G29750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1733.3e-5429124297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdr++Pianv+rim++vlPa+akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl+vyl++yre+eg
  OMERI02G29750.1  29 REQDRLMPIANVIRIMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSVYLHRYREFEG 122
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      e+
  OMERI02G29750.1 123 ES 124
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-4922127IPR009072Histone-fold
SuperFamilySSF471133.88E-3831129IPR009072Histone-fold
PfamPF008084.0E-253598IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.6E-176280No hitNo description
PROSITE patternPS0068506581IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.6E-178199No hitNo description
PRINTSPR006157.6E-17100118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEAGYPGAAN GAAAADGNGG AQQAAPAIRE QDRLMPIANV IRIMRRVLPA HAKISDDAKE  60
TIQECVSEYI SFITGEANER CQREQRKTIT AEDVLWAMSR LGFDDYVEPL SVYLHRYREF  120
EGESRGVGVG AARGDHHHGH HHGHVGGMLK SRAQGSMVTH HDMQMHAAMY GGGAVPPPPH  180
PPPHHHAFHQ LMPPHHGQYA PPYDMYGGEH GMAAYYGGMY APGSGGNGGD GSGSSGSGGA  240
GTPQTVNFEH QHPFGYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-4027119193NF-YB
4awl_B7e-4027119294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-4027119294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2642840.0AY264284.1 Oryza sativa (indica cultivar-group) leafy cotyledon 1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624920.11e-123PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ84W662e-65NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0E0CQW80.0A0A0E0CQW8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA005701-PA1e-123(Oryza sativa Indica Group)
STRINGLOC_Os02g49370.11e-123(Oryza sativa Japonica Group)
STRINGORGLA02G0264000.11e-123(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-63nuclear factor Y, subunit B6